unigene(RDQZB000003)

summary

Unigene name:
Unigene length: 1058
Organism: 翘嘴鲌

sequence

DNA sequence: TAAAGACCTAGGGCTGATAAACTGGGGATTTTACTGCCTTGGAAGAAATGAAACGATTTTATTCAAATCATCATCTTGATCACATGCATTTTAAGATACAAATTCCCACAATATCCATTGAAGCAGAGGCCAAAATGTGTGCAGCAAGAAAAAAAAAAAAGAAGTCACAATTTTTACCCAACAGCTGTCTGATACCAACTCTGATGTAGGTTAATGTAGCTACATTGGCATAAAATGTATTTGAGAGACAAGCAGATATTTAAAACATGAACTTAAATAAAATGAGTAATGTTACAAAGAAATGTTACACACAATATTATAAGCTTTAAACCAATTATTATGGACTGAGGCAGCAGCGTTACCATACAACGTTTCTAATTTTTGCGTTTCCAGCGTGTCATTACAGTTTGGTTTCGGCATGTTATAGTGGATAAGGAAAGCTGCACACCCTCACACATCTGCACACACCCCTCAACTGCATAAAAAGAACTGAACAAATAAACAATGAGGCCAATATTTCCAGGGGTCAGTAAACAGGGGATATGTTTCTCATATACTCGCACATACATACACTATCTCTCTCTTACACACACCCGATTCTTCCTTAAACCTGGTCTCTGAGTTTGGCCAGTCTCTGAGAGAGCTCGTCCTGTTCTGCAGATGCTACGCTGGTTCCCACTGATCCTGTCTGACCTTGAGGAAGCTCCATATTGAGGTCCAGCCCAGCCTCATCCGCCATTTCCATCATCAGAGTATCGACTTGACCCTGTGGTGTGGTCAGTGTTGTGGTACTGCTCATTGTGTCTTCCATTTGAGCCGTCTGTACGTCCAGAGTTTCAAATTGACGCTCAAATTTATCCATCAGACCTGAAATCTTCTCAAGGTTCATGCTCTTCAGGGTCGCATCCATGCCCTTCACAACCCCAGCCATAGACTTGGTGACCTGGTTCATGGTGACAGCCGTCTGTACTCGTGCAGCCACCGCATCCACTCTTGCGCTCATTCTAAGGAAGTTCACTGATTGGTTCTTCTGGCGGATAGCGTTTTCTGCATGTATC
Protein sequence: IHAENAIRQKNQSVNFLRMSARVDAVAARVQTAVTMNQVTKSMAGVVKGMDATLKSMNLEKISGLMDKFERQFETLDVQTAQMEDTMSSTTTLTTPQGQVDTLMMEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLAKLRDQV